PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G198400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 361aa    MW: 39764.1 Da    PI: 6.1233
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G198400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.41e-26208257352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++i +++l++yF++pi+ AA+e++v+lTvLK++CR++GI+RWPhRk+ksl
  Sevir.5G198400.1.p 208 DHIGFDELRRYFYMPITRAAREMNVGLTVLKKRCRELGIARWPHRKMKSL 257
                         6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.837197278IPR003035RWP-RK domain
PfamPF020423.5E-21210257IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MAMVPYCDGD ADWYHFPPLC PPSPLALLSE GESYYDLPIF PPPPAAGDHQ FFSNQLPPVP  60
VDSATVGLDD ALLQPLGDID LEAFDNADEH KAPHHGRHTM IVPAGQHAVG QEYAGVDVVD  120
DADEKPMAPH HGRHTMVGQE YAGVDGVIVV DDADQKPMAM VDCFLPGANN AFESAMPPPQ  180
PSLPLPARGR RSVDHRSAPA PGGKTRLDHI GFDELRRYFY MPITRAAREM NVGLTVLKKR  240
CRELGIARWP HRKMKSLKSL ILSVQEMGTG MNPAAVQQEL AALETYCALM EENPAIELTE  300
RTKKLRQACF KESYKRRRAA AVNVVDHIFN FDEHQFHHQL PPPPSPSSAE RHGSGSFFGY  360
*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0039332e-66AP003933.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0066C06.
GenBankAP0042582e-66AP004258.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0024F24.
GenBankAP0149572e-66AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126092e-66CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971918.10.0PREDICTED: uncharacterized protein LOC101757335
TrEMBLK3XT460.0K3XT46_SETIT; Uncharacterized protein
STRINGSi005102m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128882330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.14e-35RWP-RK domain-containing protein